Vaccine Injured Pilot Testifies: “It has taken everything from me and my family – we have been ignored and silenced”

<p class="has-text-align-justify"><strong>Cody Flint, a pilot, and Lt. Col. Theresa Long, an army physician, gave their testimonies during a three-hour panel discussion hosted by U.S. Senator Ron Johnson on 3 November in Washington D.C. The expert panel included doctors and medical researchers who treat Covid injection injuries and they were joined by patients who have experienced adverse events to Covid injections.</strong></p> <p class="has-text-align-justify">Cody Flint, a previously healthy 33-year-old agricultural pilot, testified he received his first dose of the Pfizer injection on 1 February 2021.  Within 30 mins of having the injection he displayed symptoms of an adverse reaction.  Two days later he was back in the cockpit flying and almost immediately knew something was wrong: he developed tunnel vision, his headache worsened and at one point he almost “blacked out.”  He was later diagnosed with <a href="https://www.specsavers.co.uk/hearing/ear-health/perilymph-fistula">perilymph fistula</a>.</p> <figure class="wp-block-video aligncenter wp-block-embed is-type-video is-provider-videopress"> <figcaption>Expert Panel on Medical Mandates and Vaccine Injuries, Washington D.C.,<br /> 3 November 2021 – Testimony Pilot Cody Flint (3 mins)</figcaption> </figure> <p class="has-text-align-justify">In September, Lt. Col. Theresa Long, Brigade Surgeon for the First Aviation Brigade of the U.S. Army, made an <a href="https://www.naturalnews.com/2021-09-29-aerospace-medicine-specialist-ground-vaxxed-pilots.html">unprecedented call to Pentagon leaders</a> asking them to ground all pilots in all services who have had a Covid injection.</p> <p class="has-text-align-justify">Long testified: “I saw five patients in clinics, two of which presented with chest pain days to weeks after vaccination and were subsequently diagnosed with pericarditis … the third pilot was vaccinated and felt like he was drunk, chronically fatigued within 24 hours of vaccination … In one morning, I had to ground three out of three pilots due to vaccine injuries.”</p> <figure class="wp-block-video aligncenter wp-block-embed is-type-video is-provider-videopress"> <figcaption>Expert Panel on Medical Mandates and Vaccine Injuries, Washington D.C.,<br /> 3 November 2021 – Testimony Lt. Col. Theresa Long (15 mins)</figcaption> </figure> <p class="has-text-align-justify">Watch the full <em>Expert Panel on Medical Mandates and Vaccine Injuries</em> (3 hours) on <em>The Highwire</em> <a href="https://thehighwire.com/videos/live-in-d-c-expert-panel-on-medical-mandates-vaccine-injuries/">HERE</a>. Flint’s testimony begins at 27:02 mins and Long’s testimony begins at 30:40 mins.</p> <p class="has-text-align-justify">The policy of airlines has been, for many years, that people with an increased risk of blood clots could only fly under strict supervision.  Even the <a href="https://www.cdc.gov/ncbddd/dvt/travel.html">CDC warns</a>: “anyone traveling more than four hours, whether by air, car, bus, or train, can be at risk for blood clots.”  And the <a href="https://www.nhs.uk/live-well/healthy-body/prevent-dvt-when-you-travel/">NHS warns</a>: “DVT (deep vein thrombosis) is when a blood clot forms in a deep vein, usually in the leg, and blocks blood flow. It can happen after sitting still during long journeys by bus, train, or air.” </p> <p class="has-text-align-justify">The first indication that there may be a problem for pilots post-Covid injection was in June 2021 when <a href="https://hugotalks.com/2021/06/17/did-4-british-airways-pilots-die-of-vaccine-this-week-hugo-talks-lockdown/">an audio recording went viral on social media</a> claiming three British Airways pilots died post-injection within one week.  A week or so previously, Spain and Russia had recommended those who have had a Covid injection <a href="https://www.thelibertybeacon.com/4-british-airways-pilots-dead-following-covid-19-injections-while-spain-russia-concerned-about-clots-during-air-travel/">should not fly due to the risk of blood clotting</a>.</p> <p class="has-text-align-justify"><a href="https://rumble.com/vnpo0l-dr.-northrup-explains-why-pilots-are-dying-in-flight.-defeat-covid-with-gra.html">During an interview</a> last month <a href="https://www.drnorthrup.com/about/">Dr. Christiane Northrup</a> explained that the risk of blood clotting increases post-Covid injection.  This is because the spike proteins in the Covid injections interact with the ACE receptors lining the blood vessels. The lining of the blood vessels is no longer smooth and this causes clotting. D-Dimer tests show that 60-70% of people who have had a Covid injection have micro blood clots, hence the moniker “clotshot.” </p> <p class="has-text-align-justify">According to a 2014 study published in the Journal of Thrombosis and Haemostasis, <a href="https://thecoloradoherald.com/2021/thousands-of-flights-cancelled-as-vaccinated-pilots-fall-ill-or-die/">pilots suffer an increased risk of clotting issues</a> due to frequent and prolonged air travel.</p> <p class="has-text-align-justify">“If you are a pilot, you’re sitting for long periods of time at high altitude and so any tendency to clot will be vastly increased,” Dr. Northrup said, add to this the “clotshot” and it’s a recipe for disaster.</p> <p>Further resources:</p> <ul> <li><a href="https://www.thegatewaypundit.com/2021/10/breaking-exclusive-american-airlines-cancels-98-flights-phoenix-sky-harbor-whistleblower-reveals-weather-not-cause-crew-shortages/">American Airlines Cancels 104 Flights at Phoenix Sky Harbor – Whistle-blower Reveals Weather Is NOT The Cause, It’s Crew Shortages</a>, 31 October 2021</li> <li><a href="https://www.youtube.com/watch?v=J_R-BnDsZDk">Video: An American Military Man Warns About the Magic Potion</a>, 26 October 2021 (2 mins)</li> <li><a href="https://www.lifesitenews.com/blogs/united-airlines-pilot-leads-covid-revolt-files-medical-freedom-lawsuit-with-2000-fellow-workers/">United Airlines pilot leads COVID revolt, files medical freedom lawsuit with 2,000 fellow workers</a>, 25 October 2021</li> <li><a href="https://www.lifesitenews.com/news/delta-airlines-pilot-dies-mid-flight-days-after-vaccination-report/">Delta Airlines pilot dies mid-flight days after vaccination</a>, 14 Oct 2021</li> <li><a href="https://rumble.com/vnmcl5-pilot-speaks-out-against-vaccine-mandates-warns-of-shifting-base-syndrome.html">Video: Pilot Speaks Out Against Vaccine Mandates, Warns of Shifting Base Syndrome</a>, 11 October 2021 (2 mins)</li> <li><a href="https://www.naturalnews.com/2021-09-29-aerospace-medicine-specialist-ground-vaxxed-pilots.html">Army physician and aerospace medicine specialist calls on Pentagon to order all pilots who have received COVID-19 vaccine to be grounded</a>, 29 September 2021</li> </ul> <figure class="wp-block-post-featured-image"><img alt="" class="attachment-post-thumbnail size-post-thumbnail wp-post-image jetpack-lazy-image" data-attachment-id="26578" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="Featured-8" data-large-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?fit=639%2C359&ssl=1" data-lazy-sizes="(max-width: 639px) 100vw, 639px" data-lazy-srcset="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?w=1280&ssl=1 1280w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?resize=300%2C169&ssl=1 300w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?resize=1024%2C576&ssl=1 1024w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?resize=768%2C432&ssl=1 768w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?resize=1200%2C675&ssl=1 1200w" data-medium-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?fit=300%2C169&ssl=1" data-orig-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?fit=1280%2C720&ssl=1" data-orig-size="1280,720" data-permalink="https://theexpose.uk/2021/11/06/vaccine-injured-pilot-testifies-it-has-taken-everything-from-me-and-my-family-we-have-been-ignored-and-silenced/featured-8/" data-recalc-dims="1" height="359" loading="lazy" src="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/Featured-8.png?resize=639%2C359&ssl=1" srcset="data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7" width="639" /></figure> <div class="wp-container-61868273f2389 wp-block-group" readability="4.2752590673575"> <div class="wp-block-group__inner-container" readability="6.6917098445596"> <hr class="wp-block-separator" /> <p class="has-text-align-center has-custom-font"><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><mark class="has-inline-color"><strong>The Exposé is now censored on</strong><br /> <strong>Google, Facebook & Twitter.</strong></mark></a><strong><a href="https://web.archive.org/web/20210823121616/https://dailyexpose.co.uk/2021/08/09/august-fundraising-campaign-we-rely-solely-on-your-support/"><br /></a></strong><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><mark class="has-inline-color has-vivid-red-color"><strong>So we need your help to ensure</strong><br /> <strong>we can continue to bring you the</strong></mark><mark class="has-inline-color"><br /></mark></a><strong><a href="https://theexpose.uk/2021/10/01/october-fundraising-campaign/"><mark class="has-inline-color has-vivid-red-color">facts the mainstream refuse to…</mark></a></strong></p> <p class="has-text-align-center has-custom-font"><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>We’re not funded by the Government</strong><br /> <strong>to publish lies and propaganda on their</strong></a><br /> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>behalf like the mainstream media.</strong></a><br /> <strong><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/">Instead we rely solely on your support, so<br /></a></strong><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>please support us in our efforts to bring</strong></a> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>you</strong></a><br /> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>honest, reliable, investigative journalism.</strong></a><br /> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>It’s quick and easy…</strong></a></p> <p><mark class="has-inline-color has-vivid-red-color"><strong>Please choose your preferred</strong><br /> <strong>method to show your support</strong></mark><br /></p> <div class="wp-block-image"> <figure class="aligncenter is-resized"><a href="https://www.paypal.com/donate?hosted_button_id=864RBRS7GH9LA"><img alt="" class="wp-image-9610" data-attachment-id="9610" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-159" data-large-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?fit=332%2C89&ssl=1" data-medium-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?fit=300%2C80&ssl=1" data-orig-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/01/july-fundraising-campaign/image-159-3/" height="49" loading="lazy" sizes="(max-width: 180px) 100vw, 180px" src="https://i1.wp.com/dailyexpose.co.uk/wp-content/uploads/2021/06/image-159.png?resize=219%2C59&ssl=1" srcset="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?w=332&ssl=1 332w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?resize=300%2C80&ssl=1 300w" width="180" /></a></figure> </div> <div class="wp-block-image"> <figure class="aligncenter is-resized"><a href="https://theexpose.uk/donate-today"><img alt="" class="wp-image-9614" data-attachment-id="9614" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-163" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?fit=332%2C89&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?fit=300%2C80&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/01/july-fundraising-campaign/image-163-3/" height="49" loading="lazy" sizes="(max-width: 180px) 100vw, 180px" src="https://i0.wp.com/dailyexpose.co.uk/wp-content/uploads/2021/06/image-163.png?resize=217%2C59&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?w=332&ssl=1 332w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?resize=300%2C80&ssl=1 300w" width="180" /></a></figure> </div> <div class="wp-block-image"> <figure class="aligncenter size-full is-resized"><a href="https://theexpose.uk/support-daily-expose-with-a-monthly-subscription/"><img alt="" class="wp-image-11682" data-attachment-id="11682" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-250" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?fit=332%2C89&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?fit=300%2C80&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/13/july-fundraising-campaign-we-rely-solely-on-your-support/image-250/" data-recalc-dims="1" height="51" loading="lazy" sizes="(max-width: 190px) 100vw, 190px" src="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?resize=190%2C51&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?w=332&ssl=1 332w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?resize=300%2C80&ssl=1 300w" width="190" /></a></figure> </div> <div class="wp-block-image"> <figure class="aligncenter is-resized"><a href="https://commerce.coinbase.com/checkout/0e00a4d8-4c4a-43b1-8746-6e477dac325d"><img alt="" class="wp-image-9617" data-attachment-id="9617" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-166" data-large-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?fit=332%2C89&ssl=1" data-medium-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?fit=300%2C80&ssl=1" data-orig-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/01/july-fundraising-campaign/image-166-3/" height="50" loading="lazy" sizes="(max-width: 187px) 100vw, 187px" src="https://i1.wp.com/dailyexpose.co.uk/wp-content/uploads/2021/06/image-166.png?resize=216%2C58&ssl=1" srcset="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?w=332&ssl=1 332w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?resize=300%2C80&ssl=1 300w" width="187" /></a></figure> </div> <hr class="wp-block-separator" /> <div class="wp-block-coblocks-post-carousel"> <div class="coblocks-slick pb-8" data-slick='{"slidesToScroll":1,"arrow":true,"slidesToShow":3,"infinite":true,"adaptiveHeight":false,"draggable":true,"rtl":false,"responsive":[{"breakpoint":1024,"settings":{"slidesToShow":3}},{"breakpoint":600,"settings":{"slidesToShow":2}},{"breakpoint":480,"settings":{"slidesToShow":1}}]}'> <div class="wp-block-coblocks-post-carousel__item" readability="16.427807486631"> <div class="wp-block-coblocks-post-carousel__content" readability="17.454545454545"><time datetime="2021-11-06T12:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 6, 2021</time><a href="https://theexpose.uk/2021/11/06/dr-vernon-coleman-a-nice-cup-of-fluoride/" alt="Dr Vernon Coleman – “Putting Fluoride in drinking water does far more harm than good”">Dr Vernon Coleman – “Putting Fluoride in drinking water does far more harm than good”</a> <p>The UK’s four chief medical officers (including the inevitable and, to me, …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="10.296028880866"> <div class="wp-block-coblocks-post-carousel__content" readability="10.628158844765"><time datetime="2021-11-06T07:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 6, 2021</time><a href="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/" alt="The UK Government is trying to conceal the fact the Covid-19 Vaccines have raised all-cause mortality by 15% and that the Vaccinated may be developing Acquired Immunodeficiency Syndrome">The UK Government is trying to conceal the fact the Covid-19 Vaccines have raised all-cause mortality by 15% and that the Vaccinated may be developing Acquired Immunodeficiency Syndrome</a> <p>The purpose of government Covid-19 statistics is no longer to inform the …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="14.558011049724"> <div class="wp-block-coblocks-post-carousel__content" readability="15.027624309392"><time datetime="2021-11-05T14:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/spain-a-care-workers-dismissal-for-refusing-to-have-a-covid-injection-is-overturned-in-court/" alt="Spain: A Care Worker’s Dismissal for refusing to have a Covid Injection Is Overturned in Court">Spain: A Care Worker’s Dismissal for refusing to have a Covid Injection Is Overturned in Court</a> <p>The Social Court of Bilbao has declared "void" the dismissal of a …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="16.074742268041"> <div class="wp-block-coblocks-post-carousel__content" readability="16.840206185567"><time datetime="2021-11-05T13:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/us-covid-19-vaccine-mandates-make-it-difficult-for-student-athletes-to-get-college-scholarships/" alt="US Covid-19 Vaccine Mandates Make it Difficult for Student-Athletes to Get College Scholarships">US Covid-19 Vaccine Mandates Make it Difficult for Student-Athletes to Get College Scholarships</a> <p>In the United States, student-athletes at public high schools are struggling to …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item"> <div class="wp-block-coblocks-post-carousel__content" readability="10.796019900498"><time datetime="2021-11-05T11:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/san-francisco-to-force-5-year-olds-to-show-covid-19-vaccine-passports/" alt="San Francisco to Force 5-Year-Olds to Show Covid-19 Vaccine Passports">San Francisco to Force 5-Year-Olds to Show Covid-19 Vaccine Passports</a> <div class="wp-block-coblocks-post-carousel__excerpt" readability="14.896551724138"><a href="https://twitter.com/bergerbell/status/1455775773013397505?s=20" rel="nofollow">https://twitter.com/bergerbell/status/1455775773013397505?s=20</a> San Francisco is set to be the first state in the …</div> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="13.983695652174"> <div class="wp-block-coblocks-post-carousel__content" readability="14.434782608696"><time datetime="2021-11-05T09:30:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/covid-19-have-average-effectiveness-of-minus-seventy-three-percent/" alt="Latest UKHSA report shows the Covid-19 Vaccines have an average real world effectiveness of MINUS 73%">Latest UKHSA report shows the Covid-19 Vaccines have an average real world effectiveness of MINUS 73%</a> <p>Last week we told you how the Covid-19 vaccines were proving to …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="14.970297029703"> <div class="wp-block-coblocks-post-carousel__content" readability="15.683168316832"><time datetime="2021-11-05T08:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/bmj-editor-dr-peter-doshi-gives-evidence-to-expert-panel-on-medical-mandates-and-covid-injection-injuries/" alt="BMJ Editor Dr. Peter Doshi Gives Evidence to Expert Panel on Medical Mandates and Covid Injection Injuries">BMJ Editor Dr. Peter Doshi Gives Evidence to Expert Panel on Medical Mandates and Covid Injection Injuries</a> <p>On Wednesday, U.S. Senator Ron Johnson held a three-hour panel discussion in …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="12.124444444444"> <div class="wp-block-coblocks-post-carousel__content" readability="12.515555555556"><time datetime="2021-11-05T06:35:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/fully-vacccinated-account-for-83-percent-covid-19-deaths-in-england/" alt="BREAKING – Fully Vaccinated accounted for 83% of Covid-19 Deaths, 68% of Hospitalisations & 55% of Cases in England over the past month">BREAKING – Fully Vaccinated accounted for 83% of Covid-19 Deaths, 68% of Hospitalisations & 55% of Cases in England over the past month</a> <p>The latest figures published by the new UK Health Security Agency on …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="14.243243243243"> <div class="wp-block-coblocks-post-carousel__content" readability="14.702702702703"><time datetime="2021-11-04T15:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 4, 2021</time><a href="https://theexpose.uk/2021/11/04/biden-says-childrens-covid-19-vaccination-program-will-be-fully-operational-by-november-8th/" alt="Biden Says Children’s Covid-19 Vaccination Program Will be “Fully Operational” by November 8th">Biden Says Children’s Covid-19 Vaccination Program Will be “Fully Operational” by November 8th</a> <p>The United States is only days away from the Biden regime rolling …</p> </div> </div> </div> </div> <div class="wp-block-image"> <figure class="aligncenter size-full is-resized"><a href="https://gab.com/dailyexpose"><img alt="" class="wp-image-12593" data-attachment-id="12593" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-83" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?fit=300%2C100&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?fit=300%2C100&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?fit=300%2C100&ssl=1" data-orig-size="300,100" data-permalink="https://theexpose.uk/2021/08/11/indiana-doctor-destroys-cdc-covid-narrative-at-school-board-meeting/image-83-7/" data-recalc-dims="1" height="67" loading="lazy" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?resize=199%2C67&ssl=1" width="199" /></a></figure> </div> </div> </div> <a title="Share this page to Telegram"><img alt="Share this page to Telegram" class="wpts-teleg-icon" src="https://theexpose.uk/wp-content/plugins/wp-telegram-sharing/img/t-logo.svg" width="64" /></a> <h3 class="jp-relatedposts-headline"><em>Related</em></h3> <br /> <br /> source <a href="https://theexpose.uk/2021/11/06/vaccine-injured-pilot-testifies-it-has-taken-everything-from-me-and-my-family-we-have-been-ignored-and-silenced/">https://theexpose.uk/2021/11/06/vaccine-injured-pilot-testifies-it-has-taken-everything-from-me-and-my-family-we-have-been-ignored-and-silenced/</a>

revolution Vaccine Injured Pilot Testifies: “It has taken everything from me and my family – we have been ignored and silenced”

Cody Flint, a pilot, and Lt. Col. Theresa Long, an army physician, gave their testimonies during a three-hour panel discussion hosted by U.S...

Read More...»

The UK Government is trying to conceal the fact the Covid-19 Vaccines have raised all-cause mortality by 15% and that the Vaccinated may be developing...

<hr class="wp-block-separator is-style-wide" /> <p><strong>The purpose of government Covid-19 statistics is no longer to inform the public with scientific truth, in order to help them formulate a valid medical decision on the risks and benefits of Covid-19 Vaccines.</strong></p> <p><strong>It is to influence the public with misleading or false or politically biased or medically biased information and to suppress any information which does not suit their political agenda in order to effectively make that choice for them</strong>.</p> <hr class="wp-block-separator is-style-wide" /> <p class="has-text-align-center has-custom-font"><em>By a concerned reader</em></p> <hr class="wp-block-separator is-style-wide" /> <div class="wp-block-image"> <figure class="aligncenter size-large"><img alt="" class="wp-image-26558" data-attachment-id="26558" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-96" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?fit=639%2C268&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?fit=300%2C126&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?fit=1200%2C504&ssl=1" data-orig-size="1200,504" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-96-10/" data-recalc-dims="1" height="268" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?resize=639%2C268&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?resize=1024%2C430&ssl=1 1024w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?resize=300%2C126&ssl=1 300w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?resize=768%2C323&ssl=1 768w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-96.png?w=1200&ssl=1 1200w" width="639" /></figure> </div> <hr class="wp-block-separator is-style-wide" /> <p>On November 2nd, the Daily Mail published an article revealing that…</p> <p><em>1. UK statistics watchdog scolds PHE’s replacement body for publishing ‘misleading’ figures which anti-vaxxers have seized as proof that Covid jabs don’t work<br /> 2. Over the past few weeks, the agency’s data shows infection rates are higher in fully-vaccinated adults compared to the unjabbed. <br /> 3. Anti-vaxx commentators and campaigners have seized the data as proof that Covid vaccines don’t work.</em></p> <p>The UK’s Statistics Watchdog is The Office of Statistics Regulation (TOSR for short). Yes Offstats has told the UKHSA that their Stats are off. And now they are nicely back on message.</p> <p>TOSR director general Ed Humpherson wrote to the UKHSA’s boss Dr Jenny Harries on November1 thanking her for the changes she had made and is quoted in the Daily Mail as saying</p> <p><strong>‘It remains the case that the surveillance report includes rates per 100,000 which can be used to argue that vaccines are not effective,’<br /> ‘I know that this is not the intention of the surveillance report, but the potential for misuse remains.</strong></p> <p>There is the tacit admission by the Government that the purpose of their stats is not to enable the public to decide for themselves whether the vaccines are effective or not. No their stats should not even be able to support an argument that the vaccines are ineffective. Indeed any such construction of UKHSA statistics would be a misuse of government data according to the Director General.</p> <p>This is his candid admission that the use of all UKHSA data is exclusively to prove the vaccines are effective, and any government statistics agency which departs from that line shall be re-adjusted by TOSR. He is defining the UKHSA as a pro vaccine propaganda outfit, whose mandate is only to supply information for one side of the debate. No person in the UK can be expected to make an informed choice of whether to take Pfizer’s experimental gene therapy when it is presented to them by the government as an unquestionably effective Covid vaccination.<br /> <a rel="noreferrer noopener" href="https://www.dailymail.co.uk/health/article-10155799/Stats-watchdog-scolds-PHE-replacement-data-misuse-supports-anti-vaxxers.html" target="_blank">https://www.dailymail.co.uk/health/article-10155799/Stats-watchdog-scolds-PHE-replacement-data-misuse-supports-anti-vaxxers.html</a><strong>‘</strong></p> <p>The writer therefore calls on Ed Humpherson, to –</p> <p>1. Withdraw his instruction to the UKHSA to only present data that supports vaccination and to suppress data that has the capability of being used to support vaccine refusal. Because the law requires that the public are given the opportunity to give an informed consent for all medical interventions.<br /> 2. To publish forthwith under a Freedom of Information Request, Any and All instructions to other government agencies to the same purpose, namely of influencing the public with one sided propaganda, rather than informing it in a balanced manner with both sides of the argument.<br /> 3. To publicly withdraw all such instructions and start presenting the truth to the British people and trust them to make the best decision for themselves, their families and their children.</p> <p>Here is the latest UKHSA data from their Vaccine Surveillance Report for Week44.</p> <p><strong>Cases reported by specimen date between week 40 & 43 2021</strong> – <a rel="noreferrer noopener" href="https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1031157/Vaccine-surveillance-report-week-44.pdf" target="_blank">https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1031157/Vaccine-surveillance-report-week-44.pdf</a> </p> <div class="wp-block-image"> <figure class="aligncenter size-large"><img alt="" class="wp-image-26524" data-attachment-id="26524" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-81" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?fit=639%2C202&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?fit=300%2C95&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?fit=1458%2C461&ssl=1" data-orig-size="1458,461" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-81-10/" data-recalc-dims="1" height="202" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?resize=639%2C202&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?resize=1024%2C324&ssl=1 1024w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?resize=300%2C95&ssl=1 300w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?resize=768%2C243&ssl=1 768w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?resize=1200%2C379&ssl=1 1200w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?w=1458&ssl=1 1458w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-81.png?w=1278&ssl=1 1278w" width="639" /></figure> </div> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26549" data-attachment-id="26549" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-92" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-92.png?fit=639%2C359&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-92.png?fit=300%2C168&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-92.png?fit=784%2C440&ssl=1" data-orig-size="784,440" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-92-10/" data-recalc-dims="1" height="359" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-92.png?resize=639%2C359&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-92.png?w=784&ssl=1 784w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-92.png?resize=300%2C168&ssl=1 300w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-92.png?resize=768%2C431&ssl=1 768w" width="639" /></figure> </div> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26550" data-attachment-id="26550" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-93" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-93.png?fit=639%2C358&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-93.png?fit=300%2C168&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-93.png?fit=783%2C439&ssl=1" data-orig-size="783,439" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-93-10/" data-recalc-dims="1" height="358" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-93.png?resize=639%2C358&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-93.png?w=783&ssl=1 783w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-93.png?resize=300%2C168&ssl=1 300w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-93.png?resize=768%2C431&ssl=1 768w" width="639" /></figure> </div> <p>Here is how it fits into the previous 8 weeks of data.</p> <p>The table below shows the weekly decline in doubly vaccinated immune system performance compared to unvaxxed people. Vaccine efficacy is measured using Pfizer’s vaccine effectiveness formula… </p> <p><em>(Unvaxxed case rate – Vaxxed case rate)/the Larger of Unvaxxed or Vaxxed case rate – We are using the normalised absolute ratio of vaxxed to unvaxxed case numbers to determine vaccine efficiency just as Pfizer itself does.</em></p> <div class="wp-block-image"> <figure class="aligncenter size-large"><img alt="" class="wp-image-26525" data-attachment-id="26525" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-82" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?fit=639%2C199&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?fit=300%2C94&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?fit=1308%2C408&ssl=1" data-orig-size="1308,408" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-82-10/" data-recalc-dims="1" height="199" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?resize=639%2C199&ssl=1" srcset="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?resize=1024%2C319&ssl=1 1024w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?resize=300%2C94&ssl=1 300w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?resize=768%2C240&ssl=1 768w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?resize=1200%2C374&ssl=1 1200w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-82.png?w=1308&ssl=1 1308w" width="639" /></figure> </div> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26544" data-attachment-id="26544" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-90" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-90.png?fit=639%2C342&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-90.png?fit=300%2C161&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-90.png?fit=910%2C487&ssl=1" data-orig-size="910,487" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-90-10/" data-recalc-dims="1" height="342" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-90.png?resize=639%2C342&ssl=1" srcset="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-90.png?w=910&ssl=1 910w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-90.png?resize=300%2C161&ssl=1 300w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-90.png?resize=768%2C411&ssl=1 768w" width="639" /></figure> </div> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26547" data-attachment-id="26547" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-91" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-91.png?fit=639%2C342&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-91.png?fit=300%2C160&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-91.png?fit=909%2C486&ssl=1" data-orig-size="909,486" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-91-10/" data-recalc-dims="1" height="342" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-91.png?resize=639%2C342&ssl=1" srcset="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-91.png?w=909&ssl=1 909w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-91.png?resize=300%2C160&ssl=1 300w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-91.png?resize=768%2C411&ssl=1 768w" width="639" /></figure> </div> <p>And now, as if by magic, the consistent pattern of the 7 weeks from week35 – week41, has miraculously slowed down and stopped altogether. Well Hallelujah – we are delivered from vaccine induced AIDS coincident with a scolding by the government of its statistics agency. </p> <p>The writer is not buying this miracle cure and is still projecting the same result that the unmassaged data from Weeks35-41 predict, namely…</p> <p><strong>The 8 UK PHE Vaccine Surveillance Report figures on Covid cases from Week35-42 showed that doubly vaccinated 40-79 year olds had lost lost 50% of their immune system capability by October 24 and are consistently losing a further 4-5% every week (between 3.7% and 7.9%). Not withstanding what we understand to be the corrupted figures for Week43, we continue to project that 30-49 year olds will have zero Covid/viral defence at best, or a form of vaccine mediated AIDS at worst, by the first week in January and all doubly vaccinated people over 30 will have completely lost that part of their immune system which deals with Covid in the next 17 weeks.</strong></p> <p>Meanwhile in other news, which you will not be hearing about from any UK government agency regulated by TOSR, Swedish Researchers have discovered one mechanism through which the Vaccines degrade the immune system.</p> <p><strong>SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination In Vitro</strong> – <a href="https://www.mdpi.com/1999-4915/13/10/2056/htm" rel="noreferrer noopener" target="_blank">https://www.mdpi.com/1999-4915/13/10/2056/htm<br /></a>by Hui Jiang and Ya-Fang Mei<br /> Department of Molecular Biosciences, The Wenner–Gren Institute, Stockholm University, SE-10691 Stockholm, Sweden and Department of Clinical Microbiology, Virology, Umeå University, SE-90185 Umeå, Sweden</p> <p><strong>Abstract</strong><br /> Severe acute respiratory syndrome coronavirus 2 (SARS–CoV–2) has led to the coronavirus disease 2019 (COVID–19) pandemic, severely affecting public health and the global economy. Adaptive immunity plays a crucial role in fighting against SARS–CoV–2 infection and directly influences the clinical outcomes of patients. Clinical studies have indicated that patients with severe COVID–19 exhibit delayed and weak adaptive immune responses; however, the mechanism by which SARS–CoV–2 impedes adaptive immunity remains unclear. Here, by using an in vitro cell line, we report that the SARS–CoV–2 spike protein significantly inhibits DNA damage repair, which is required for effective V(D)J recombination in adaptive immunity. Mechanistically, we found that the spike protein localizes in the nucleus and inhibits DNA damage repair by impeding key DNA repair protein BRCA1 and 53BP1 recruitment to the damage site. Our findings reveal a potential molecular mechanism by which the spike protein might impede adaptive immunity and underscore the potential side effects of full-length spike-based vaccines. </p> <p><strong>The significance of this study is not merely that mRNA vaccines prevent your DNA from repairing itself which will cause immunological disorders, cancer and premature ageing. The problem is that the mRNA is going into your cell nuclei. That is straight up gene therapy – not vaccination. mRNA should go directly to the protein assembly plants in your cells called ribosomes, which it should instruct to manufacture the protein spikes. It should not be going anywhere near the cell nucleus. Entering the cell nucleus means it is performing or effectively performing reverse transcription and making itself a part of or an addition to your genetic code. </strong></p> <p><strong>Basic Immunology</strong></p> <p>Vaccines work by simulating a viral attack and provoking the immune system into responding as if you have had the virus.  They are supposed to train the immune system to the point where you develop natural immunity to the virus. So the argument that vaccine immunity is better than natural immunity could never have been true because vaccine immunity is an inferior form of natural immunity resulting from the body’s immune response to a vaccine generated simulation rather than to a real world infection. The vaccines program your cells to produce the 1273 Amino Acid S1 Spike Protein, which for the sake of completeness is presented below, with 60 amino acids per line..</p> <p>1 ) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS<br /> 2) NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV<br /> 3)  NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE<br /> 4)  GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT<br /> 5)  LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK<br /> 6)  CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN<br /> 7)  CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD<br /> 8)  YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC<br /> 9)  NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN<br /> 10) FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP<br /> 11) GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY<br /> 12) ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI<br /> 13) SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE<br /> 14) VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC<br /> 15) LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM<br /> 16) QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN<br /> 17) TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA<br /> 18) SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA<br /> 19) ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP<br /> 20) LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL<br /> 21) QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD<br /> 22) SEPVLKGVKLHYT</p> <p>Here is the Amino Acid Look up table…</p> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26528" data-attachment-id="26528" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-83" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-83.png?fit=639%2C267&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-83.png?fit=300%2C126&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-83.png?fit=643%2C269&ssl=1" data-orig-size="643,269" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-83-10/" data-recalc-dims="1" height="267" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-83.png?resize=639%2C267&ssl=1" srcset="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-83.png?w=643&ssl=1 643w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-83.png?resize=300%2C126&ssl=1 300w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-83.png?resize=640%2C269&ssl=1 640w" width="639" /></figure> </div> <p>Whereas the SARS-CoV-2 isolated from Ethiopian patients had: <em>genome sizes were 29,860, 29,856, and 29,871 – </em> <a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8459669/" rel="noreferrer noopener" target="_blank">https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8459669/</a> <br /> There are 3 nucleotides (genome RNA bases) per Amino Acid. So Covid-19 has around 9953 Amino Acids in total. The virus is therefore around 8x larger than its spike protein. Vaccine immunity results from antibodies to the spike protein. Natural immunity results from antibodies to the entire virus. The immune system chops up virus proteins into small sections and produces a different antibody for each section. So natural immunity will produce 8x as many antibody types as virus immunity. This is one reason why it is so much better. In one analysis that compared more than 32,000 people, they found that the risk of developing symptomatic COVID-19 was 27 times higher among the vaccinated, and the risk of hospitalisation 8 times higher – <a href="https://thepulse.one/2021/08/29/covid-infection-provides-greater-protection-than-being-fully-vaccinated-new-study/" rel="noreferrer noopener" target="_blank">https://thepulse.one/2021/08/29/covid-infection-provides-greater-protection-than-being-fully-vaccinated-new-study/</a> and <a href="https://www.medrxiv.org/content/10.1101/2021.08.24.21262415v1" rel="noreferrer noopener" target="_blank">https://www.medrxiv.org/content/10.1101/2021.08.24.21262415v1</a>.</p> <p>Simply put natural immunity is 8x as broad based as vaccine immunity for Covid19 spike protein vaccines. </p> <p>Vaccines do two things for the immune system. They show it the enemy and they agitate the immune system to simulate a systemic infection, to persuade it that the enemy it is being shown is really dangerous. This persuades the immune system to rush off and make loads of antibodies which can take out the offending cut up sections of the enemy protein, the spike protein, for Covid vaccines. </p> <p>The purpose of the above mini course in basic immunology is to educate the reader to the point where they understand that vaccines cannot lose effectiveness. Vaccines are DIGITAL. They are not ANALOGUE. They offer a 2-3 week training course to the immune system which either works or does not work. After that they have nothing whatsoever to do. They carry out no further process which can lose efficiency. Either they show the immune system part of the virus and alert it to the danger it poses or they do not. We know that the covid19 vaccines work initially, from the initial case number results. So they succeed in training the immune system. At the point their job is done. They have nothing more to do. There is no immunological mechanism by which vaccines can lose their efficiency because they have finished the purpose of their existence within 2-3 weeks, the normal period of a viral infection. The concept that they lose efficiency after 2-3 weeks is just immunological nonsense.  </p> <p>So the rapid deterioration in immune response to Covid19 post vaccination can only be due to the vaccines damaging the immune system. It cannot be due to them ‘losing efficiency’. The fact that the boosters do improve covid response (by alerting the immune system even more and telling it that covid19 – which has already been identified twice by the first two shots, is really really really dangerous and it had better go to defcon3) shows categorically that vaccines have not lost their efficacy. Their training program is still effective. So the deterioration in immune response is an unwanted side effect of the vaccination. It is the gene therapy part of the vaccines. It is the continual over production of spike proteins that appears to wear out the poor old immune system. And boosters will make that worse.</p> <h4><strong>Further Government Covid Data Manipulation</strong></h4> <p>The ONS published deaths from all causes by vaccination status in excel format <a href="https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/datasets/deathsbyvaccinationstatusengland" rel="noreferrer noopener" target="_blank">https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/datasets/deathsbyvaccinationstatusengland</a></p> <p>We combine their tables 4 and 5 as below. Their data covers the period from Janaury8 to September24. It includes 10-17 year olds in the unvaxxed group. these could not be vaccinated prior to August23. So one needs to remove them and further one needs to find a way to adjust the data for their dependency upon age because vaccinated people are generally older that unvaccinated people. The ONS does this with their Age Standardised Mortality Rate formula. <a href="https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/methodologies/weeklycovid19agestandardisedmortalityratesbyvaccinationstatusenglandmethodology" rel="noreferrer noopener" target="_blank">https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/methodologies/weeklycovid19agestandardisedmortalityratesbyvaccinationstatusenglandmethodology</a></p> <p>They use this to provide ‘Age Adjusted’ figures. they do this because the fact is that every single week from late January to September24 the rate of death among the vaccinated has far exceeded that rate among the unvaxxed. Even when we remove the 10-17 year olds as we have done in the table below (we calculated below that there are 4,434,375 of them in the ONS invaxxed group), it is still the case that for most of May you were 5x more likely to die if you were in the vaccinated group than if you were in the unvaccinated group.</p> <p>Admittedly, even with the 10-17 year olds removed the vaccinated group was still considerably older than the unvaxxed group in May. But this is not the sort of thing the government want to be publishing. So they try to shift your focus to their ‘Age adjusted’ figures, which they call their ‘Age standardised’ figures because that sounds less manipulative. But here is the raw data with the teenagers removed…</p> <div class="wp-block-image"> <figure class="aligncenter size-large"><a href="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?ssl=1" target="_blank" rel="noopener"><img alt="" class="wp-image-26530" data-attachment-id="26530" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-84" data-large-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?fit=639%2C722&ssl=1" data-medium-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?fit=265%2C300&ssl=1" data-orig-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?fit=1318%2C1490&ssl=1" data-orig-size="1318,1490" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-84-10/" data-recalc-dims="1" height="722" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?resize=639%2C722&ssl=1" srcset="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?resize=906%2C1024&ssl=1 906w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?resize=265%2C300&ssl=1 265w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?resize=768%2C868&ssl=1 768w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?resize=1200%2C1357&ssl=1 1200w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-84.png?w=1318&ssl=1 1318w" width="639" /></a></figure> </div> <p>The ONS in their Table 4 and Table 5 calculated the death rates per 100k using the complicated age standardised mortality rate formula explained in their report. This is supposed to remove age as a confounding factor in the table above. The main confounding component is the inclusion of death rates for 10-17 year olds in the unvaccinated group during a period when nobody under 18 could become vaccinated. The obvious method of fixing that disparity would be for the ONS to simply remove people whose age was less than 18 from the group. But they chose instead to leave them in and then take them back out again with a complicated formula as bureaucrats love to do.</p> <p>However we can see how many 10-17 year olds there were in the ONS unvaxxed group on 20-Aug-21 (16-17 year olds were called to be vaccinated on 23-August-21) as follows.</p> <p>UK 10-17 = 5,305,102 (ONS mid year population estimates June2020)<br /> UK population 10+ = 49,771,233 (ONS mid year population estimates June2020)</p> <p>On 23-Aug-21 –</p> <p>UK singly vaxxed = 39,910,686 (<a rel="noreferrer noopener" href="https://coronavirus.data.gov.uk/details/vaccinations" target="_blank">https://coronavirus.data.gov.uk/details/vaccinations</a>)  <br /> UK unvaxxed 10+ = 9,860,547 <br /> ONS unvaxxed = 8,242,156<br /> Ratio ONS/UK = 83.587%<br /> 83.587% of 5,305,102 = 4,434,375</p> <p>So we should have 4,434,375 10-17s to remove. We took that number from the 10+ unvaxxed population column above to calculate the 18+ column.</p> <p>Having removed the teenagers we can see where the death rate will be when age has worked its way out of the data (by October22 when everyone over 18 who wanted a second shot has had 10 weeks in which to get one given their call for the 1st shot was June18 and there should be an 8 week gap between shots. So their call for the 2nd shot was August13). </p> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26533" data-attachment-id="26533" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-85" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-85.png?fit=639%2C370&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-85.png?fit=300%2C174&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-85.png?fit=1015%2C588&ssl=1" data-orig-size="1015,588" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-85-10/" data-recalc-dims="1" height="370" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-85.png?resize=639%2C370&ssl=1" srcset="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-85.png?w=1015&ssl=1 1015w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-85.png?resize=300%2C174&ssl=1 300w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-85.png?resize=768%2C445&ssl=1 768w" width="639" /></figure> </div> <p><strong>The Death Factor is simply the ratio of the Vaccinated all cause death rate per 100k to the Unvaccinated</strong></p> <p>All death rates per 100k are calculated by multiplying the number of deaths by 100,000 and dividing them by the population of the group</p> <p>If we go forward by 5 weeks from September24 to October29 we reach the time when everybody 18 and over has had the opportunity to get vaccinated if they want it. So the age disparity between the vaccinated and the unvaccinated will have settled down.  The graph above shows that the final position will be that the death rate in the vaccinated people will be TWICE the death rate in unvaccinated people TODAY.</p> <p>Even that 2:1 ratio is affected by age because younger fitter more athletic and sporty people and people with faith in God or in nature, do not feel the need to take the vaccine because they trust their own bodies and nature or God more than they trust massive profit driven government lobbying Pharmaceutical companies.</p> <p>However the ONS does not mention this 2:1 final ratio of all cause mortality rates in the vaxxed compared to the unvaxxed in their monolateral pro gene therapy Bulletins. Instead they tell us the following in their latest bureaucratic extravaganza of age standardisation…</p> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26535" data-attachment-id="26535" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-86" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-86.png?fit=639%2C538&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-86.png?fit=300%2C253&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-86.png?fit=1015%2C855&ssl=1" data-orig-size="1015,855" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-86-10/" data-recalc-dims="1" height="538" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-86.png?resize=639%2C538&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-86.png?w=1015&ssl=1 1015w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-86.png?resize=300%2C253&ssl=1 300w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-86.png?resize=768%2C647&ssl=1 768w" width="639" /></figure> </div> <p>This does not plot true death rates by vaccination stauts against time. It plots Age Standardised Mortality Rate by vaccination status against time.</p> <p>So the UKHSA says that unvaxxed people are dying of Covid at 5x the rate of the doubly vaxxed due to their age standardisation mortality rate formula. Whereas the raw figures for the week to September24 show that the unvaxxed are only dying at twice the rate of the doubly vaxxed (<strong>2.97:1.5</strong>) from Covid. Furthermore the doubly vaxxed are dying of all causes at twice the rate of the unvaxxed ! So we must look at the UKHSA Age Standardised Mortality Rates for all causes for the last 10 weeks. Here they are from Table2.</p> <div class="wp-block-image"> <figure class="aligncenter size-full"><img alt="" class="wp-image-26536" data-attachment-id="26536" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-87" data-large-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-87.png?fit=638%2C446&ssl=1" data-medium-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-87.png?fit=300%2C210&ssl=1" data-orig-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-87.png?fit=638%2C446&ssl=1" data-orig-size="638,446" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-87-10/" data-recalc-dims="1" height="446" loading="lazy" sizes="(max-width: 638px) 100vw, 638px" src="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-87.png?resize=638%2C446&ssl=1" srcset="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-87.png?w=638&ssl=1 638w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-87.png?resize=300%2C210&ssl=1 300w" width="638" /></figure> </div> <p>These are saying the the doubly vaxxed have had on average a true non age biased death rate which is 58% of the unvaxxed death rate from all causes. If that analysis had any bearing on reality at all, then since the doubly vaxxed (who make up the vast majority of the population) would be dying at 58% of the rate of the unvaxxed, all cause mortality for the entire population would be close to 58% of the 5 year average. Because unvaxxed people at present are not dying in significant numbers from Covid and have had no medical intervention. So they would represent the 5 year all cause mortality rate. Well here is the present all cause mortality rate for the entire country…<a rel="noreferrer noopener" href="https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/bulletins/deathsregisteredweeklyinenglandandwalesprovisional/22october2021" target="_blank">https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/bulletins/deathsregisteredweeklyinenglandandwalesprovisional/22october2021</a></p> <div class="wp-block-image"> <figure class="aligncenter size-large"><img alt="" class="wp-image-26538" data-attachment-id="26538" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-88" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?fit=639%2C239&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?fit=300%2C112&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?fit=1300%2C486&ssl=1" data-orig-size="1300,486" data-permalink="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/image-88-10/" data-recalc-dims="1" height="239" loading="lazy" sizes="(max-width: 639px) 100vw, 639px" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?resize=639%2C239&ssl=1" srcset="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?resize=1024%2C383&ssl=1 1024w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?resize=300%2C112&ssl=1 300w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?resize=768%2C287&ssl=1 768w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?resize=1200%2C449&ssl=1 1200w, https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/11/image-88.png?w=1300&ssl=1 1300w" width="639" /></figure> </div> <p>All Cause Mortality has not dropped to 58% of the 5 year average. No. It has risen to be around 15% greater than that average. The Age Standardised Mortality Rate produces a work of bureaucratic fiction by a factor of around 2 – so desperate are the government to cover up the true picture for Covid, which is that the vaccinated are presently raising all cause mortality in the UK by 15%. And since they make up 80% of the population, their true age independent death rate will need to be 19% above that of the unvaxxed in order to achieve that.</p> <p><strong>What this means is that for every person the vaccines are saving from covid, they are killing 1.19 people from side effects.</strong></p> <p>Last year at this time all cause mortality was also elevated above the 5 year average due to significant numbers of covid deaths from Wuhan alhpa. This year we have just as many cases, but many fewer deaths, thank God. Because delta, although more infectious, is less lethal. So the elevation is not due to delta. It must be due to the vaccines.</p> <p>In conclusion: The ASMR formula is biased in favour of the doubly vaxxed and against the unvaxxed by a factor of 2.</p> <p>What this means is that the true Covid death rate among the vaccinated is no better than among the unvaccinated, which is the inescapable immunological conclusion from the fact that case rates are higher in the vaccinated. For death rates should follow case rates.</p> <div class="wp-container-6186827f11989 wp-block-group" readability="4.3758344459279"> <div class="wp-block-group__inner-container" readability="6.849132176235"> <hr class="wp-block-separator" /> <p class="has-text-align-center has-custom-font"><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><mark class="has-inline-color"><strong>The Exposé is now censored on</strong><br /> <strong>Google, Facebook & Twitter.</strong></mark></a><strong><a href="https://web.archive.org/web/20210823121616/https://dailyexpose.co.uk/2021/08/09/august-fundraising-campaign-we-rely-solely-on-your-support/"><br /></a></strong><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><mark class="has-inline-color has-vivid-red-color"><strong>So we need your help to ensure</strong><br /> <strong>we can continue to bring you the</strong></mark><mark class="has-inline-color"><br /></mark></a><strong><a href="https://theexpose.uk/2021/10/01/october-fundraising-campaign/"><mark class="has-inline-color has-vivid-red-color">facts the mainstream refuse to…</mark></a></strong></p> <p class="has-text-align-center has-custom-font"><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>We’re not funded by the Government</strong><br /> <strong>to publish lies and propaganda on their</strong></a><br /> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>behalf like the mainstream media.</strong></a><br /> <strong><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/">Instead we rely solely on your support, so<br /></a></strong><a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>please support us in our efforts to bring</strong></a> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>you</strong></a><br /> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>honest, reliable, investigative journalism.</strong></a><br /> <a href="https://theexpose.uk/2021/11/01/november-fundraising-campaign/"><strong>It’s quick and easy…</strong></a></p> <p><mark class="has-inline-color has-vivid-red-color"><strong>Please choose your preferred</strong><br /> <strong>method to show your support</strong></mark><br /></p> <div class="wp-block-image"> <figure class="aligncenter is-resized"><a href="https://www.paypal.com/donate?hosted_button_id=864RBRS7GH9LA"><img alt="" class="wp-image-9610" data-attachment-id="9610" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-159" data-large-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?fit=332%2C89&ssl=1" data-medium-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?fit=300%2C80&ssl=1" data-orig-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/01/july-fundraising-campaign/image-159-3/" height="49" loading="lazy" sizes="(max-width: 180px) 100vw, 180px" src="https://i1.wp.com/dailyexpose.co.uk/wp-content/uploads/2021/06/image-159.png?resize=219%2C59&ssl=1" srcset="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?w=332&ssl=1 332w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-159.png?resize=300%2C80&ssl=1 300w" width="180" /></a></figure> </div> <div class="wp-block-image"> <figure class="aligncenter is-resized"><a href="https://theexpose.uk/donate-today"><img alt="" class="wp-image-9614" data-attachment-id="9614" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-163" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?fit=332%2C89&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?fit=300%2C80&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/01/july-fundraising-campaign/image-163-3/" height="49" loading="lazy" sizes="(max-width: 180px) 100vw, 180px" src="https://i0.wp.com/dailyexpose.co.uk/wp-content/uploads/2021/06/image-163.png?resize=217%2C59&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?w=332&ssl=1 332w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-163.png?resize=300%2C80&ssl=1 300w" width="180" /></a></figure> </div> <div class="wp-block-image"> <figure class="aligncenter size-full is-resized"><a href="https://theexpose.uk/support-daily-expose-with-a-monthly-subscription/"><img alt="" class="wp-image-11682" data-attachment-id="11682" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-250" data-large-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?fit=332%2C89&ssl=1" data-medium-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?fit=300%2C80&ssl=1" data-orig-file="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/13/july-fundraising-campaign-we-rely-solely-on-your-support/image-250/" data-recalc-dims="1" height="51" loading="lazy" sizes="(max-width: 190px) 100vw, 190px" src="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?resize=190%2C51&ssl=1" srcset="https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?w=332&ssl=1 332w, https://i0.wp.com/theexpose.uk/wp-content/uploads/2021/07/image-250.png?resize=300%2C80&ssl=1 300w" width="190" /></a></figure> </div> <div class="wp-block-image"> <figure class="aligncenter is-resized"><a href="https://commerce.coinbase.com/checkout/0e00a4d8-4c4a-43b1-8746-6e477dac325d"><img alt="" class="wp-image-9617" data-attachment-id="9617" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-166" data-large-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?fit=332%2C89&ssl=1" data-medium-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?fit=300%2C80&ssl=1" data-orig-file="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?fit=332%2C89&ssl=1" data-orig-size="332,89" data-permalink="https://theexpose.uk/2021/07/01/july-fundraising-campaign/image-166-3/" height="50" loading="lazy" sizes="(max-width: 187px) 100vw, 187px" src="https://i1.wp.com/dailyexpose.co.uk/wp-content/uploads/2021/06/image-166.png?resize=216%2C58&ssl=1" srcset="https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?w=332&ssl=1 332w, https://i1.wp.com/theexpose.uk/wp-content/uploads/2021/06/image-166.png?resize=300%2C80&ssl=1 300w" width="187" /></a></figure> </div> <hr class="wp-block-separator" /> <div class="wp-block-coblocks-post-carousel"> <div class="coblocks-slick pb-8" data-slick='{"slidesToScroll":1,"arrow":true,"slidesToShow":3,"infinite":true,"adaptiveHeight":false,"draggable":true,"rtl":false,"responsive":[{"breakpoint":1024,"settings":{"slidesToShow":3}},{"breakpoint":600,"settings":{"slidesToShow":2}},{"breakpoint":480,"settings":{"slidesToShow":1}}]}'> <div class="wp-block-coblocks-post-carousel__item" readability="16.427807486631"> <div class="wp-block-coblocks-post-carousel__content" readability="17.454545454545"><time datetime="2021-11-06T12:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 6, 2021</time><a href="https://theexpose.uk/2021/11/06/dr-vernon-coleman-a-nice-cup-of-fluoride/" alt="Dr Vernon Coleman – “Putting Fluoride in drinking water does far more harm than good”">Dr Vernon Coleman – “Putting Fluoride in drinking water does far more harm than good”</a> <p>The UK’s four chief medical officers (including the inevitable and, to me, …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="13.644230769231"> <div class="wp-block-coblocks-post-carousel__content" readability="14.884615384615"><time datetime="2021-11-06T09:30:00+00:00" class="wp-block-coblocks-post-carousel__date">November 6, 2021</time><a href="https://theexpose.uk/2021/11/06/vaccine-injured-pilot-testifies-it-has-taken-everything-from-me-and-my-family-we-have-been-ignored-and-silenced/" alt="Vaccine Injured Pilot Testifies: “It has taken everything from me and my family – we have been ignored and silenced”">Vaccine Injured Pilot Testifies: “It has taken everything from me and my family – we have been ignored and silenced”</a> <p>Cody Flint, a pilot, and Lt. Col. Theresa Long, an army physician, …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="14.558011049724"> <div class="wp-block-coblocks-post-carousel__content" readability="15.027624309392"><time datetime="2021-11-05T14:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/spain-a-care-workers-dismissal-for-refusing-to-have-a-covid-injection-is-overturned-in-court/" alt="Spain: A Care Worker’s Dismissal for refusing to have a Covid Injection Is Overturned in Court">Spain: A Care Worker’s Dismissal for refusing to have a Covid Injection Is Overturned in Court</a> <p>The Social Court of Bilbao has declared "void" the dismissal of a …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="16.074742268041"> <div class="wp-block-coblocks-post-carousel__content" readability="16.840206185567"><time datetime="2021-11-05T13:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/us-covid-19-vaccine-mandates-make-it-difficult-for-student-athletes-to-get-college-scholarships/" alt="US Covid-19 Vaccine Mandates Make it Difficult for Student-Athletes to Get College Scholarships">US Covid-19 Vaccine Mandates Make it Difficult for Student-Athletes to Get College Scholarships</a> <p>In the United States, student-athletes at public high schools are struggling to …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item"> <div class="wp-block-coblocks-post-carousel__content" readability="10.796019900498"><time datetime="2021-11-05T11:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/san-francisco-to-force-5-year-olds-to-show-covid-19-vaccine-passports/" alt="San Francisco to Force 5-Year-Olds to Show Covid-19 Vaccine Passports">San Francisco to Force 5-Year-Olds to Show Covid-19 Vaccine Passports</a> <div class="wp-block-coblocks-post-carousel__excerpt" readability="14.896551724138"><a href="https://twitter.com/bergerbell/status/1455775773013397505?s=20" rel="nofollow">https://twitter.com/bergerbell/status/1455775773013397505?s=20</a> San Francisco is set to be the first state in the …</div> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="13.983695652174"> <div class="wp-block-coblocks-post-carousel__content" readability="14.434782608696"><time datetime="2021-11-05T09:30:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/covid-19-have-average-effectiveness-of-minus-seventy-three-percent/" alt="Latest UKHSA report shows the Covid-19 Vaccines have an average real world effectiveness of MINUS 73%">Latest UKHSA report shows the Covid-19 Vaccines have an average real world effectiveness of MINUS 73%</a> <p>Last week we told you how the Covid-19 vaccines were proving to …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="14.970297029703"> <div class="wp-block-coblocks-post-carousel__content" readability="15.683168316832"><time datetime="2021-11-05T08:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/bmj-editor-dr-peter-doshi-gives-evidence-to-expert-panel-on-medical-mandates-and-covid-injection-injuries/" alt="BMJ Editor Dr. Peter Doshi Gives Evidence to Expert Panel on Medical Mandates and Covid Injection Injuries">BMJ Editor Dr. Peter Doshi Gives Evidence to Expert Panel on Medical Mandates and Covid Injection Injuries</a> <p>On Wednesday, U.S. Senator Ron Johnson held a three-hour panel discussion in …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="12.124444444444"> <div class="wp-block-coblocks-post-carousel__content" readability="12.515555555556"><time datetime="2021-11-05T06:35:00+00:00" class="wp-block-coblocks-post-carousel__date">November 5, 2021</time><a href="https://theexpose.uk/2021/11/05/fully-vacccinated-account-for-83-percent-covid-19-deaths-in-england/" alt="BREAKING – Fully Vaccinated accounted for 83% of Covid-19 Deaths, 68% of Hospitalisations & 55% of Cases in England over the past month">BREAKING – Fully Vaccinated accounted for 83% of Covid-19 Deaths, 68% of Hospitalisations & 55% of Cases in England over the past month</a> <p>The latest figures published by the new UK Health Security Agency on …</p> </div> </div> <div class="wp-block-coblocks-post-carousel__item" readability="14.243243243243"> <div class="wp-block-coblocks-post-carousel__content" readability="14.702702702703"><time datetime="2021-11-04T15:00:00+00:00" class="wp-block-coblocks-post-carousel__date">November 4, 2021</time><a href="https://theexpose.uk/2021/11/04/biden-says-childrens-covid-19-vaccination-program-will-be-fully-operational-by-november-8th/" alt="Biden Says Children’s Covid-19 Vaccination Program Will be “Fully Operational” by November 8th">Biden Says Children’s Covid-19 Vaccination Program Will be “Fully Operational” by November 8th</a> <p>The United States is only days away from the Biden regime rolling …</p> </div> </div> </div> </div> <div class="wp-block-image"> <figure class="aligncenter size-full is-resized"><a href="https://gab.com/dailyexpose"><img alt="" class="wp-image-12593" data-attachment-id="12593" data-comments-opened="1" data-image-caption="" data-image-description="" data-image-meta="{"aperture":"0","credit":"","camera":"","caption":"","created_timestamp":"0","copyright":"","focal_length":"0","iso":"0","shutter_speed":"0","title":"","orientation":"0"}" data-image-title="image-83" data-large-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?fit=300%2C100&ssl=1" data-medium-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?fit=300%2C100&ssl=1" data-orig-file="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?fit=300%2C100&ssl=1" data-orig-size="300,100" data-permalink="https://theexpose.uk/2021/08/11/indiana-doctor-destroys-cdc-covid-narrative-at-school-board-meeting/image-83-7/" data-recalc-dims="1" height="67" loading="lazy" src="https://i2.wp.com/theexpose.uk/wp-content/uploads/2021/08/image-83.png?resize=199%2C67&ssl=1" width="199" /></a></figure> </div> </div> </div> <a title="Share this page to Telegram"><img alt="Share this page to Telegram" class="wpts-teleg-icon" src="https://theexpose.uk/wp-content/plugins/wp-telegram-sharing/img/t-logo.svg" width="64" /></a> <h3 class="jp-relatedposts-headline"><em>Related</em></h3> <br /> <br /> source <a href="https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/">https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/</a>

revolution The UK Government is trying to conceal the fact the Covid-19 Vaccines have raised all-cause mortality by 15% and that the Vaccinated may be developing...

The purpose of government Covid-19 statistics is no longer to inform the public with scientific truth, in order to help them formulate a va...

Read More...»

House Progressives and moderates united to pass a massive infrastructure deal

<div><img class="ff-og-image-inserted" src="https://cdn.vox-cdn.com/thumbor/SChI0B0KEbVxfiA-5BWUoupU4hg=/0x0:4396x2302/fit-in/1200x630/cdn.vox-cdn.com/uploads/chorus_asset/file/22990225/1236351351.jpg" /></div> <p>The House passed a $1.2 trillion infrastructure bill Friday, but did not vote on a much larger, sweeping climate and social spending measure as originally planned.</p> <p>The result was a major step forward for President Joe Biden’s agenda, but a blow to progressives who’ve long pushed for the two bills to be tied together. Progressives were able to extract a commitment from House moderates to vote for the spending measure by November 15, although that pledge came with an important caveat.</p> <p>The now successful infrastructure bill passed the House on a bipartisan basis, 228-206, with <a href="https://twitter.com/mkraju/status/1456826746838429699?s=20">13 Republicans voting in favor</a>. The legislation was a compromise between a bipartisan group of lawmakers, includes major investments in roads, water quality, bridges, and broadband. It’s known as BIF — the bipartisan infrastructure framework — since members of both parties have backed it. Because it has already passed the Senate, it now heads to President Joe Biden’s desk to become law.</p> <p>The $1.75 trillion social spending bill, dubbed the Build Back Better Act (BBB), did not receive a vote, however, and won’t be heading to the Senate. It contains historic funding for early childhood education and climate as well as key health care reforms.</p> <p>The House action followed a chaotic day of back-and-forth over the two votes. Progressives have consistently demanded that votes for the two bills — the bipartisan infrastructure bill and the social spending package — be linked. They feared that moderates, who back BIF, would abandon the spending bill if the infrastructure bill passed first.</p> <p>To satisfy this demand, Democratic leaders scheduled a vote on both for Friday. This week, however, a group of moderate Democrats including Reps. Kurt Schrader, Stephanie Murphy and Jared Golden, urged a delay for the social spending bill until it received a score from the Congressional Budget Office (CBO) laying out how much it would add to the national debt.</p> <p>In response to these concerns, House Speaker Nancy Pelosi decided to keep the infrastructure vote on the books, and delay the vote on the Build Back Better Act until lawmakers could get more information.</p> <p>This strategy immediately prompted uproar from progressives, making it appear that the infrastructure vote would fail. Because Democrats have such narrow margins in the House, they can’t afford to lose more than three members on any vote. That gives any group of moderates or progressives the power to hold up legislation.</p> <p>Biden intervened Friday night, and with Pelosi, offered progressives and moderates a deal. In exchange for progressive votes for the infrastructure package, moderates would pledge to vote for the spending bill, so long as the Congressional Budget Office — which will lay out how much the measure adds to spending and the deficit — finds the measure’s fiscal impact is as projected.</p> <p>In the end, <a href="https://twitter.com/mkraju/status/1456826746838429699?s=20">all but six progressives</a> were willing to take the deal, enough for the infrastructure bill to pass the House.</p> <p>The fate of the social spending bill, however, is now uncertain. Moderates are holding out for a score from the Congressional Budget Office before they move forward. And it may be that the CBO finds the spending bill would add to the deficit more than expected. In that case, moderates would not be required to vote for the bill, though they did <a href="https://twitter.com/sarahnferris/status/1456808013399003149?s=20">promise</a> to try “to resolve any discrepancies in order to pass the Build Back Better legislation.” Some could conceivably refuse to vote for it at all. In the best case scenario, a vote on the bill isn’t expected to take place until later this month at the earliest and then, should it pass, it must still get through the Senate as well.</p> <p>Of concern to progressives is whether the spending package will stay alive. Without a concurrent vote on the social spending measure, progressives don’t really have much leverage to ensure that it won’t be abandoned entirely.</p> <p>Previously, Congressional Progressive Caucus leader Rep. Pramila Jayapal (D-WA) said that progressives trusted Biden to deliver the support of moderate Sens. Joe Manchin and Kyrsten Sinema for the bill. Both senators have demanded major cuts and reworking to the spending package over the past few weeks, and Manchin, in particular, has expressed concern about the cost.</p> <p>Now, they’ll get a chance to see if moderates in both the House and the Senate actually come through for the legislation, if they’ll continue to whittle it down, or if they will come to oppose it altogether.</p> <p>Both bills are quite large. The infrastructure bill will spend $1.2 trillion on roads, water quality, bridges, and broadband, while the social spending and climate bill would put $1.75 trillion toward early childhood education and clean energy as well as key health care reforms. Together, they’d represent nearly $3 trillion in spending spread over several years that would come less than a year after Congress <a href="https://www.vox.com/policy-and-politics/2021/3/6/22315536/stimulus-package-passes-checks-unemployment">authorized $1.9 trillion</a> in a third coronavirus relief bill.</p> <p>Biden has emphasized that the entirety of the $1.75 trillion bill would be paid for with revenue raisers including a new corporate minimum tax, a tax on stock buybacks, and an additional tax on top income earners. An estimate from the Joint Committee on Taxation suggested the measure would bring in about $1.5 trillion in revenue over a decade. That calculation did not include newly added provisions like policies to cut prescription drug costs and to ramp up IRS tax enforcement that are expected to bring in further revenue. Progressives have noted, too, that the bipartisan infrastructure bill is not fully paid for and would add an estimated $256 billion to the debt, <a href="https://www.nytimes.com/2021/08/05/us/politics/infrastructure-bill.html">according to the Congressional Budget Office</a>.</p> <p>Despite this, the scale of the legislation still has moderate lawmakers in both the House and Senate worried, and they’re not fully convinced by the estimates they’ve seen. <a href="https://budgetmodel.wharton.upenn.edu/estimates/2021/11/1/reconciliation-framework">A Wharton analysis</a>, for instance, found that Biden’s proposed framework could add as much as $2.5 trillion to the deficit.</p> <p>Their demands for a CBO score — which would lay out the measure’s effects on spending, revenue, and the deficit — stem from worries that these programs will increase the deficit further, and that the revenue raisers included in the legislation won’t be sufficient to cover these costs.</p> <p>Moderates have said they’d feel more comfortable moving forward if they knew for certain that the bill would have limited impacts on the debt.</p> <p>“We have, because of Covid, already spent about $6 trillion roughly, and we need to approach this in a fiscally responsible manner, and the only way to do that is to know how much this package costs,” Murphy has previously said.</p> <p>It could take as much as two weeks for the House to get a CBO score on the bill, something the Senate is also waiting on for the budget reconciliation process. The deal struck between progressives and moderates projected CBO data would come by November 15.</p> <p>Any delays in getting that score could pose a problem for getting the spending bill passed before the year is over — or even before next spring, when lawmakers will begin to turn their attention to the 2022 midterm elections.</p> <p>Congress will be on recess for two weeks in November and out again in the second half of December. Should the CBO score come in two weeks, lawmakers would receive it right before leaving Washington, DC, for the Thanksgiving recess. After returning from that break, lawmakers would have roughly 10 legislative days left before their winter recess to get the bill through the House and Senate.</p> <p>Finishing the spending bill is expected to be particularly difficult given that Democrats haven’t yet agreed on what will be in it. Moderate senators are still pushing back on the size and some provisions in the spending legislation, and have winnowed it down notably in recent weeks. Progressives in both chambers are working to put provisions that have been stripped out back in, and, as was seen Friday, moderates continue to voice concerns about overall cost.</p> <p>And even once the spending bill passes the House, it will still face a long journey through the Senate. The social spending bill is being advanced through the budget reconciliation process, which allows bills to pass the Senate with a simple majority. And Democrats have a one-vote majority. But reconciliation also mandates a bill’s provisions affect the budget.</p> <p>The Senate parliamentarian, who rules on what is and isn’t allowed in a reconciliation bill, will need to make a decision on what can and can’t be included in the bill after Democrats finish their internal negotiations and the CBO score is released. After that, again, as part of the reconciliation process, the bill will also have to go through a step known as “vote-a-rama” in which senators will be able to add amendments to the legislation and alter it even more.</p> <p>Once passed in the Senate, it will head back to the House, where lawmakers will need to approve the Senate’s changes.</p> <p>It’s also important to remember that the spending bill isn’t the only thing lawmakers need to address. On December 3, if Congress doesn’t take action, the government will default on its debts, triggering a possible global economic crisis, and if lawmakers don’t pass more government funding, it could shut down as well.</p> <p>A lot is riding on both bills passing the House quickly, but it’s no longer clear that can happen. And if the House fails to advance the spending bill, Biden’s full agenda — and all the benefits it hopes to bring — won’t come to fruition.</p> <br /> <br /> source <a href="https://www.vox.com/2021/11/5/22766086/infrastructure-biden-house-democrats-vote-pass-bbb-spending-bill">https://www.vox.com/2021/11/5/22766086/infrastructure-biden-house-democrats-vote-pass-bbb-spending-bill</a>

vox House Progressives and moderates united to pass a massive infrastructure deal

The House passed a $1.2 trillion infrastructure bill Friday, but did not vote on a much larger, sweeping climate and social spending measur...

Read More...»

The chicken industry’s worker safety problem

<div><img class="ff-og-image-inserted" src="https://cdn.vox-cdn.com/thumbor/IzYxH1VTyDymbx5vWHVNrDEMKDk=/0x38:1920x1043/fit-in/1200x630/cdn.vox-cdn.com/uploads/chorus_asset/file/22990042/thumb_clean.jpg" /></div> <p>Starting in the 1960s, US consumers <a href="https://ourworldindata.org/grapher/per-capita-meat-consumption-by-type-kilograms-per-year?country=~USA">began a love affair with chicken</a>. America’s proteins of choice once were beef and pork, until the poultry industry found a way to produce a lot of chicken, making it cheap and plentiful. Human workers paid the cost of that productivity as, over the past few decades, poultry processing line speeds have increased to meet this demand. But that’s happened in tandem with the decline of unions and deregulation of the industry. The result is a high rate of workplace injuries and repetitive motion disorders, with gaps in workplace safety oversight.</p> <p>For this video, we contacted Tyson Foods Inc. and the National Chicken Council for comment. The National Chicken Council (NCC), the poultry industry lobby that has repeatedly requested line speed increases, wrote that faster line speeds do not affect the pace of work because plants will add additional staff and lines to accommodate the increase in speeds. Through our reporting and our sources, we weren’t able to substantiate this claim, and the NCC did not respond when we asked for an example of when this has happened or for any other evidence that this is the industry standard.</p> <p>The NCC also mentioned that other countries also run poultry line speeds as fast as, if not faster than, the US. It’s difficult to do an apples-to-apples comparison with other countries because of the regulatory framework and union issues we cover in the video. Claire Kelloway, reporter and researcher for OpenMarkets, noted that in Europe, for example, factories <a href="https://thefern.org/2020/06/how-did-europe-manage-to-avoid-the-covid-19-catastrophe-ravaging-u-s-meatpacking-plants/">are typically smaller than US plants</a>, and there are higher rates of unionization and more industry safety regulation. The regulating agencies <a href="https://euagenda.eu/upload/publications/untitled-178347-ea.pdf">enforce longer breaks and switching up job roles</a> to avoid repetition, for example. Even so, working conditions in poultry plants are still <a href="https://www.business-humanrights.org/en/latest-news/europe-poor-working-housing-conditions-at-meat-packing-plants-responsible-for-covid-19-outbreak-among-workforce-report-alleges/">criticized</a> there.</p> <p>While the NCC cites a decline in workplace injuries, experts and advocates say this data is unreliable. It relies on workers reporting injuries to the government agency that regulates workplace safety, the Occupational Safety and Health Administration (OSHA). There are a number of reasons a poultry worker might not report an injury or illness, including language barriers or fears over their citizenship status. We mention that worker- and advocate-led surveys show high levels of injury and <a href="https://www.splcenter.org/sites/default/files/d6_legacy_files/downloads/publication/Unsafe_at_These_Speeds_web.pdf">include one example</a>, but <a href="https://foodchainworkers.org/wp-content/uploads/2012/06/Hands-That-Feed-Us-Report.pdf">there</a> <a href="https://www.uusc.org/sites/default/files/wages_and_working_conditions_in_arkansas_poultry_plants.pdf">are</a> <a href="https://www.hrw.org/report/2019/09/04/when-were-dead-and-buried-our-bones-will-keep-hurting/workers-rights-under-threat#">many</a> more.</p> <p>Tyson Foods Inc. disputes, without evidence, the petition that Magaly Licolli presented on behalf of the workers at the Berry Street poultry plant in Springdale, Arkansas. The company said it was misrepresented to the workers who signed it and that there were double signatures. We interviewed a worker who helped distribute the petition who said otherwise. Tyson Foods also noted that they <a href="https://www.marketwatch.com/story/tyson-raising-wages-to-keep-up-with-soaring-u-s-chicken-demand-01620694469">offered raises to poultry workers</a> in 2021 amid a labor shortage.</p> <p>We also contacted OSHA for comment. In their response, they noted that they issue citations or fines to any workplace found by federal inspectors to have violated their safety standards, but confirmed that it is under the jurisdiction of the USDA to determine line speeds. They also said that they do not track data on the use of the chemicals we mention in the video: chlorine, ammonia, and peracetic acid.</p> <p>While reporting this episode, I read <a href="https://bookshop.org/books/the-meat-racket-the-secret-takeover-of-america-s-food-business/9781451645835">Christopher Leonard’s <em>The Meat Racket</em></a><em>,</em> which I would recommend if you are interested in deep-dive reporting into the history of Tyson Foods and the poultry industry.</p> <p>I also reread Upton Sinclair’s <a href="https://bookshop.org/books/the-jungle-9781945644061/9781945644061"><em>The Jungle</em></a>. More on the <a href="https://www.nytimes.com/interactive/projects/cp/obituaries/archives/upton-sinclair-meat-industry">impact of <em>The Jungle</em></a> here.</p> <p>A congressional report recently revealed that the death toll from <a href="https://www.nytimes.com/2021/10/28/world/meatpacking-workers-covid-cases-deaths.html">Covid-19 outbreaks in meat-processing plants</a> was three times higher than previously thought:</p> <p>Read this for more coverage of the <a href="https://www.motherjones.com/food/2020/07/labor-eugene-scalia-meatpacking-osha-stress-carpal-tunnel-coronavirus-covid/">failed OSHA ergonomics</a> rule.</p> <p>Deborah Berkowitz, the former OSHA chief of staff and director of the Worker Safety and Health Program of the National Employment Law Project, was a crucial source for this story. Here is her <a href="https://www.nelp.org/publication/testimony-debbie-berkowitz-health-safety-protections-meatpacking-poultry-agricultural-workers/">recent congressional testimony</a> on workplace safety for the meat-processing industry.</p> <p>There is some reporting on whether more automation could help reduce workplace injuries. In general, <a href="https://www.wsj.com/articles/meatpackers-covid-safety-automation-robots-coronavirus-11594303535">Europe has higher levels of automation</a> in meat-processing plants than in the US.</p> <p>This story is about the history of <a href="https://www.newyorker.com/magazine/2020/07/20/how-trump-is-helping-tycoons-exploit-the-pandemic">anti-union politics</a>, specifically in Arkansas as it relates to the poultry industry.</p> <p>You can find this video and all of <a href="https://www.youtube.com/channel/UCLXo7UDZvByw2ixzpQCufnA"><strong>Vox’s videos on YouTube</strong></a>.</p> <br /> <br /> source <a href="https://www.vox.com/videos/22766151/tyson-poultry-plant-worker-safety-meat-processing">https://www.vox.com/videos/22766151/tyson-poultry-plant-worker-safety-meat-processing</a>

vox The chicken industry’s worker safety problem

Starting in the 1960s, US consumers began a love affair with chicken . America’s proteins of choice once were beef and pork, until the poul...

Read More...»

What is the price of separated immigrant families’ trauma?

<p>President Joe Biden suggested this week that paying immigrant families separated by the Trump administration <a href="https://www.wsj.com/articles/biden-administration-in-talks-to-pay-hundreds-of-millions-to-immigrant-families-separated-at-border-11635447591?mod=article_inline">$450,000 in compensation</a> per separated person — as the Department of Justice is reportedly currently discussing in settlement talks — is too much to ask the federal government. The White House has noted it hasn’t ruled out some form of payout altogether.</p> <p>Some 5,600 families were intentionally separated in immigration detention under former President Donald Trump in 2017 and 2018 after they tried to cross the southern US border without authorization, and about 1,000 families have yet to be reunited. Children taken from their parents were placed in foster care, the homes of relatives in the US, and federal detention centers, while their parents were detained separately. About 940 claims have been filed so far that would potentially be part of the settlement.</p> <p>For those families, the $450,000 figure reflects the price of dealing with what could be lifelong psychological and health consequences of the trauma of separation, as well as, in some cases of separated children, physical and sexual abuse they experienced while in <a href="https://www.usatoday.com/story/news/politics/2019/08/16/immigrant-children-separated-border-abused-foster-care-claims/2027970001/">foster care</a> and in <a href="https://www.nytimes.com/2019/02/27/us/immigrant-children-sexual-abuse.html">US custody</a>. Many advocates question whether this amount is really sufficient given the depth of the families’ trauma — and how long-term its effects could be.</p> <p>“There’s no amount of money, or anything really, that is ever going to make something like that okay,” said Conchita Cruz, co-executive director of the Asylum Seeker Advocacy Project, which has represented separated families and is part of the ongoing negotiations.</p> <p>But to some US officials, $450,000 seems too high a price.</p> <p>While eager to make amends for the family separation policy on the campaign trail, Biden said Wednesday that settlements of that size were “<a href="https://www.wsj.com/articles/biden-says-payments-to-families-separated-at-the-mexico-border-are-not-gonna-happen-11635976872">not going to happen</a>” and admonished reporters for “sending that garbage out.” White House deputy press secretary Karine Jean-Pierre later <a href="https://twitter.com/MHackman/status/1456352382590332929?s=20">clarified</a> that Biden supports settling with separated families if it is less costly than continuing litigation, but not for the amount of $450,000. The DOJ has said that price <a href="https://www.cnn.com/2021/11/04/politics/separated-families-border-lawsuit/index.html">is too steep</a> as well.</p> <p>Republicans have seized on the issue, seeking to weaponize it against Biden. Nearly a dozen Republican senators recently argued in a <a href="https://www.cornyn.senate.gov/content/news/cornyn-opposes-biden-efforts-settle-lawsuits-illegal-immigrants-millions-taxpayer-0">letter</a> to the White House that a settlement “would financially reward aliens who broke our laws” and “encourage more lawlessness” at the southern border, where the Biden administration has continued to uphold hardline Trump-era enforcement policies, which facilitate the mass expulsions of migrants.</p> <p>Texas Sen. Ted Cruz has ridiculed the idea.</p> <div> <blockquote class="twitter-tweet"> <p lang="en" dir="ltr" xml:lang="en">So <a href="https://twitter.com/JoeBiden?ref_src=twsrc%5Etfw">@JoeBiden</a> wants to give $450k to every illegal immigrant.</p> <p>And Hunter Biden paintings “sell” for $500k each.</p> <p>Perfect solution: give a Hunter Biden painting to every illegal immigrant.</p> <p>A Win-Win!</p> — Ted Cruz (@tedcruz) <a href="https://twitter.com/tedcruz/status/1456276382921732097?ref_src=twsrc%5Etfw">November 4, 2021</a></blockquote> </div> <p>But while Republicans — and Biden — have dismissed the efforts to secure what might seem like a very large settlement for separated families, it’s important to put that number in context. The federal government has <a href="https://www.npr.org/sections/codeswitch/2013/08/09/210138278/japanese-internment-redress">compensated victims</a> of its own policies before, including those subject to Japanese American internment during World War II, under which some 120,000 American citizens and residents of Japanese ancestry were sent to camps in the US following the bombing of Pearl Harbor by Japanese forces.</p> <p>And advocates argue $450,000 is not an unreasonable amount given what separated families have endured, and will continue to suffer, as a result of their separation.</p> <p>“There is robust evidence from pediatricians, mental health and public health experts that family separation causes significant trauma that can impact a child for years to come,” said Amy Fischer, Americas advocacy director at Amnesty International USA. “The trauma in this case was the point, explicitly used as a tactic by the US government to try and deter families from seeking safety in the United States. The US government then bears the responsibility to compensate families for this trauma that was caused.”</p> <p>Family separation carries long-term psychological and health impacts that might not manifest until years later, or worsen over time — outcomes that the US government predicted even before implementing the family separation policy.</p> <p>Commander Jonathan White, who previously oversaw the government’s program providing care to unaccompanied immigrant children, <a href="https://apnews.com/article/health-north-america-ap-top-news-judiciary-az-state-wire-ee8e81ca0c9542dfb997f4bef444d0e1">told</a> Congress that he repeatedly warned the officials who concocted the policy that it would likely have “significant potential for traumatic psychological injury to the child.”</p> <p>A September 2019 government watchdog report confirmed that immigrant children who entered government custody in 2018 frequently experienced “intense trauma” and that trauma was even more acute for those who were “unexpectedly separated from a parent.”</p> <p>Each child reacts to family separation differently. But psychologists have observed three main kinds of effects: Disruptions to their social attachments, increases in their emotional vulnerability, and (in some cases) post-traumatic stress disorder, said Lauren Fasig Caldwell, director of the American Psychological Association’s children, youth, and families office.</p> <p>Children may face difficulty establishing relationships, resulting in social isolation. They may show signs of anxiety and depression, aggression, and difficulty regulating their emotions or coping with stress. Stress can hinder memory, attention span, and an individual’s abilities to plan, make decisions, and process information.</p> <p>Fasig Caldwell added those symptoms could be only short-term or persist in the long run — or not even manifest until a child enters their teen years or adulthood. All of them could significantly hinder a child’s later success in school and in the workplace. Suicidal ideation stemming from PTSD and bipolar disorder may also crop up later in life, as might high-risk and self-destructive behaviors.</p> <p>Beyond those psychological effects, some children were also subjected to physical and sexual abuse while separated from their parents. For instance, one 6-year-old child was <a href="https://www.documentcloud.org/documents/6780878-2-19-19-HHS-ACF-Prod4#document/p80/a553707">hit in his foster home</a> while separated from his father for months.</p> <p>And when Honduran immigrant Daniel Paz was separated from his 7-year-old daughter Angie in May 2018, she was sent to a detention facility for children, where he says an immigration officer sexually abused her and told her that if she told anyone, she would never see her parents again. Angie said she also saw the same officer sexually abuse two girls who were even younger than her.</p> <p>“The Angie the U.S. government returned to me is not the same girl they took out of my arms in that detention center,” Paz <a href="https://www.newsweek.com/we-fled-honduras-fearing-our-lives-immigration-officers-abused-my-child-opinion-1605760">wrote</a> in Newsweek after their reunification.</p> <p>Overall, these forms of abuse can have <a href="https://www.nctsn.org/what-is-child-trauma/trauma-types/sexual-abuse/effects">severe, long-term impacts</a> on a child’s <a href="https://www.childwelfare.gov/pubpdfs/long_term_consequences.pdf">physical and mental health</a> and later sexual adjustment, and may also erode their trust in adults to care for them.</p> <figure class="e-image"><span class="e-image__inner"><span class="e-image__image" data-original="https://cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg"><picture class="c-picture" data-cid="site/picture_element-1636186348_2096_249452" data-cdata='{"asset_id":22988809,"ratio":"*"}'><source srcset="https://cdn.vox-cdn.com/thumbor/FHoPTIv9ICMzamG37wIglPealp0=/0x0:2538x1850/320x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 320w, https://cdn.vox-cdn.com/thumbor/NOKjhj-N5rjQ2q0n_Y9m6ixm8Js=/0x0:2538x1850/520x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 520w, https://cdn.vox-cdn.com/thumbor/7DZcAGdsA0PCqotFy_NQ1V_dHXA=/0x0:2538x1850/720x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 720w, https://cdn.vox-cdn.com/thumbor/nfT0KXxpjL30jPeRFTiX-Tznfa4=/0x0:2538x1850/920x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 920w, https://cdn.vox-cdn.com/thumbor/gqGyQ-3aNuktnGxVbLuDhHpLmCQ=/0x0:2538x1850/1120x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1120w, https://cdn.vox-cdn.com/thumbor/2uEfiD7cKnVJEnikNwwS-L_7Gt0=/0x0:2538x1850/1320x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1320w, https://cdn.vox-cdn.com/thumbor/Y9d0DZQbveuv3mDH-mAdDqwABpo=/0x0:2538x1850/1520x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1520w, https://cdn.vox-cdn.com/thumbor/AFu5yN73PZY12DnBNwyO1L8LtF4=/0x0:2538x1850/1720x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1720w, https://cdn.vox-cdn.com/thumbor/RcgKE3MYIS0oJHB5AlY_OP5JuIY=/0x0:2538x1850/1920x0/filters:focal(0x0:2538x1850):format(webp):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1920w" sizes="(min-width: 1221px) 846px, (min-width: 880px) calc(100vw - 334px), 100vw" type="image/webp" /> <img alt="" data-upload-width="2538" sizes="(min-width: 1221px) 846px, (min-width: 880px) calc(100vw - 334px), 100vw" src="https://cdn.vox-cdn.com/thumbor/o_mrRjuitFi8Mxyh8ZUoG5NcSvI=/0x0:2538x1850/1200x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg" srcset="https://cdn.vox-cdn.com/thumbor/arXuX6l2mKfSROZ3rYsxCca4fBA=/0x0:2538x1850/320x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 320w, https://cdn.vox-cdn.com/thumbor/Vfs2SmZLa31aumm7Ze4MQkRRWNA=/0x0:2538x1850/520x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 520w, https://cdn.vox-cdn.com/thumbor/Y8gPckp8_Bpx6dn6Y6l9BEo5AXA=/0x0:2538x1850/720x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 720w, https://cdn.vox-cdn.com/thumbor/-56sIJkfVvIeq-r6-LGiZsg9-v8=/0x0:2538x1850/920x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 920w, https://cdn.vox-cdn.com/thumbor/aJDT0tE_Y-Mb0tcDYzrvAs8-GzA=/0x0:2538x1850/1120x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1120w, https://cdn.vox-cdn.com/thumbor/4xfmiuWgFSQP56Iv4dGZYzr2iJY=/0x0:2538x1850/1320x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1320w, https://cdn.vox-cdn.com/thumbor/BrAa5Gc7zKJ_8DdK1_X1KF8lgi4=/0x0:2538x1850/1520x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1520w, https://cdn.vox-cdn.com/thumbor/KSYl4L1Y9A8fHaab5dyp0rVohwY=/0x0:2538x1850/1720x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1720w, https://cdn.vox-cdn.com/thumbor/fEqcYcGXQiAk-9lhe9nEF1dINEg=/0x0:2538x1850/1920x0/filters:focal(0x0:2538x1850):no_upscale()/cdn.vox-cdn.com/uploads/chorus_asset/file/22988809/AP18184575215171.jpg 1920w" /></picture></span></span> <figcaption><span class="e-image__meta">Yeni Gonzalez, a Guatemalan mother who was separated from her three children at the US-Mexico border, is embraced by volunteer Janey Pearl, during a news conference in 2018, in New York.</span></figcaption> <span class="e-image__meta"><cite>Craig Ruttle/AP</cite></span></figure> <p>While the money won’t undo the harms caused by US government officials, it would begin to help separated families move forward and serve as a public statement that what happened to them was wrong.</p> <p>Settlement negotiations are still ongoing, and it’s not clear what framework might be used to determine how much compensation each family would get. But Fischer said that, in devising such a framework, lawyers should consider the long-term social, emotional, and physical impacts on the child, the age of the child at the time of separation, as well as what might be sufficient for families to secure long-term care and recovery from the trauma.</p> <p>There are also historical models for administering compensation to victims of US government policies that could guide that framework. In 1983, a high-profile <a href="https://encyclopedia.densho.org/National_Council_for_Japanese_American_Redress/">class action lawsuit</a> demanded that the US government pay $27.5 billion in damages to survivors of Japanese American internment or their descendants, to redress, among other things, their psychological distress. The suit argued that the internment program was not militarily necessary as the government had claimed, but rather was motivated by “race prejudice, war hysteria and a failure of political leadership.”</p> <p>The case advanced through the appellate courts, including the Supreme Court, inspiring vigorous political debate before it was finally dismissed on a technicality. Though the litigation did not prevail, it galvanized political pressure to rectify past wrongs and ultimately led Ronald Reagan to sign the Civil Liberties Act in 1988, giving $20,000 in compensation to each survivor; around $46,000 in 2021 dollars.</p> <p>There are other ways that the US government could help separated families, aside from compensating them.</p> <p>Conchita Cruz said that there has been a push to get affected families free access to medical and mental health care and social services. That’s especially important given that many of them are noncitizens and might not be eligible for public health insurance programs, including Medicaid and the Children’s Health Insurance Program. Without insurance, continuous care often becomes prohibitively expensive. Though individuals who have been granted asylum are eligible for those programs, the process of obtaining asylum can take months or even years.</p> <p>Lawyers have also been advocating for a more immediate legal pathway for separated families to remain in the US without fear of deportation, though it’s not clear whether <a href="https://twitter.com/KannoYoungs/status/1456359957113286660?s=20">Biden would support</a> such a pathway.</p> <p>Advocates believe that dismissing these potential solutions, as some Republicans have, is a way of trivializing the trauma of the separated families.</p> <p>“The government can choose to defend instances of government officials abusing children in their custody or not,” Conchita Cruz said. “That’s really where we are.”</p> <br /> <br /> source <a href="https://www.vox.com/policy-and-politics/22763438/family-separation-settlement-biden-trump">https://www.vox.com/policy-and-politics/22763438/family-separation-settlement-biden-trump</a>

vox What is the price of separated immigrant families’ trauma?

President Joe Biden suggested this week that paying immigrant families separated by the Trump administration $450,000 in compensation per s...

Read More...»

China Threatens Taiwan Separatists With Lifelong Criminal Liability

<div class="ins_instory_dv"> <div class="ins_instory_dv_cont"><img alt="China Threatens Taiwan Separatists With Lifelong Criminal Liability" src="https://c.ndtvimg.com/2021-10/2o3b2qsg_china-taiwan_625x300_02_October_21.jpg" title="China Threatens Taiwan Separatists With Lifelong Criminal Liability" /></div> <p class="ins_instory_dv_caption sp_b">China on Friday spelled out the punishment awaiting Taiwan independence supporters. (Representational)</p> </div> <b class="place_cont">Beijing:</b> <p>China will hold those who support "Taiwan independence" criminally liable for life, it said on Friday, provoking anger and ridicule from the democratic island at a time of heightened tension across the sensitive Taiwan Strait. </p> <p>For the first time China was spelling out the punishment that awaits people deemed to back independence for Taiwan, top officials of the self-ruled island among them, as tension rises over what China regards as a province of its own. </p> <p>China has not ruled out using force to bring Taiwan under its control, despite the island's claim that it is an independent country that will defend its freedom and democracy. </p> <p>The Taiwan Affairs Office named Taiwan Premier Su Tseng-chang, Parliament Speaker You Si-kun and Foreign Minister Joseph Wu as being "stubbornly pro-Taiwan independence", as it made public for the first time that it had drawn up a list of those falling into the category. </p> <p>China will enforce punishment for those on the list by not letting them enter the mainland and its Special Administrative Regions of Hong Kong and Macau, spokeswoman Zhu Fenglian said in a statement on Friday.</p> <p>Such blacklisted individuals will not be allowed to cooperate with entities or people from the mainland, nor will their companies, or entities which fund them, be allowed to profit from the mainland, she added. </p> <p>Taiwan's Mainland Affairs Council admonished China, saying Taiwan was a democratic society with rule of law and not ruled by Beijing. "We do not accept intimidation and threats from an autocratic and authoritarian region," the council said, adding that it would take the "necessary countermeasures to safeguard the safety and well-being of the people". </p> <p>Zhu said the message China wanted to send to supporters of Taiwan independence was: "Those who forget their ancestors, betray the motherland and split the country, will never end up well, and will be spurned by the people and judged by history." </p> <p>In a Twitter post on Saturday, Taiwan's Foreign Minister, Joseph Wu, wrote, "I've received countless notes of congratulations after being blacklisted and sanctioned, for life, by the #CCP," referring to the Chinese Communist Party. </p> <p>"Many are jealous for not being recognized; some ask where they can apply for it. To deserve the rare honor, I'll keep fighting for #Taiwan's freedom and democracy." </p> <p>China believes Taiwan President Tsai Ing-wen is a separatist bent on declaring formal independence. She says Taiwan is already an independent country called the Republic of China, its formal name.</p> <p><i>(Except for the headline, this story has not been edited by NDTV staff and is published from a syndicated feed.)</i></p> <br /> <br /> source <a href="https://www.ndtv.com/world-news/china-threatens-taiwan-separatists-independence-supporters-with-lifelong-criminal-liability-2600890">https://www.ndtv.com/world-news/china-threatens-taiwan-separatists-independence-supporters-with-lifelong-criminal-liability-2600890</a>

news world China Threatens Taiwan Separatists With Lifelong Criminal Liability

China on Friday spelled out the punishment awaiting Taiwan independence supporters. (Representational) Beijing: China will hold those w...

Read More...»